PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00767.1.g00040.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 193aa    MW: 21126.4 Da    PI: 11.2622
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00767.1.g00040.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.96.4e-194184245
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                                  +i++k + qvtfskR+ g++KKA+E+   Cda+vav+ifs  gk
  Zpz_sc00767.1.g00040.1.am.mk 41 PIQDKGRSQVTFSKRKSGLFKKASEIVLRCDAKVAVVIFSRAGK 84
                                  699**************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.6143292IPR002100Transcription factor, MADS-box
SMARTSM004327.5E-203291IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-1933100IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-133454IPR002100Transcription factor, MADS-box
PfamPF003192.7E-194286IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-135469IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-136990IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
LRPRNRCRSP RRRAVASEVD PPEPSTMRKA SKGRQVITIA PIQDKGRSQV TFSKRKSGLF  60
KKASEIVLRC DAKVAVVIFS RAGKPYALGT PSVDAVLAPL PEHGGFPAPS LPPVPDRAAV  120
EATVRQLEDT KALVAAEQLR MQAVGERVMQ AAAGRGSWWQ ADVEKLGAAE LPEFARALQQ  180
LRHNVQRHID TKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701128.13e-52PREDICTED: agamous-like MADS-box protein AGL62 isoform X3
TrEMBLK7VHV62e-49K7VHV6_MAIZE; Putative MADS-box transcription factor family protein
TrEMBLB4FXA45e-49B4FXA4_MAIZE; MADS transcription factor
STRINGGRMZM5G878490_P013e-45(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28333088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.15e-25AGAMOUS-like 62